Apbb1 (BC048395) Mouse Recombinant Protein

CAT#: TP506000

Purified recombinant protein of Mouse amyloid beta (A4) precursor protein-binding, family B, member 1 (cDNA clone MGC:56969 IMAGE:6392016), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
Rabbit polyclonal Anti-Apbb1 Antibody
    • 50 ug

CNY 4628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206000 protein sequence
Red=Cloning site Green=Tags(s)

MELGLKDPEEATLSFPAQSLSPEPVPQEEEKLSQRNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNN
CIRQLSYHKNNLHDPMAGGWGEGKDLLLQLEDETLKLVEPQNQTLLHAQPIVSIRVWGVGRDSGRERDFA
YVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMSERRNARCLVNGLSLDHSKLVDVPFQVEFPAPK
NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRV
RFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQTSTSCLPAP
PAESVARRVGWTVRRGVQSLWGSLKPKRLGSQTP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 11785
UniProt ID Q9QXJ1
Refseq Size 2065
Cytogenetics 7 55.9 cM
Refseq ORF 1152
Synonyms Fe65; Rir
Summary Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its transcription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...