Cd34 (NM_133654) Mouse Recombinant Protein

CAT#: TP505966

Purified recombinant protein of Mouse CD34 antigen (Cd34), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
现货

规格
    • 20 ug

Product images

推荐一起购买 (2)
Mouse Monoclonal CD34 Antibody
    • 1 ml

CNY 9881.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205966 protein sequence
Red=Cloning site Green=Tags(s)

MQVHRDTRAGLLLPWRWVALCLMSLLHLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLI
YQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSD
YSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQI
LCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSH
QSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKA
NVTRGAQENGTGQATSRNGHSARQHVVADTEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598415
Locus ID 12490
UniProt ID Q64314
Refseq Size 2465
Cytogenetics 1 98.38 cM
Refseq ORF 1146
Synonyms AU040960
Summary Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins (By similarity).[UniProtKB/Swiss-Prot Function]
Shipping Dry Ice
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...