Stn1 (NM_175360) Mouse Recombinant Protein

CAT#: TP505901

Purified recombinant protein of Mouse STN1, CST complex subunit (Stn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205901 protein sequence
Red=Cloning site Green=Tags(s)

MECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERE
TFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGS
VRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSL
LSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEK
GLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILKCVHLNLRWDLSKAVLQRV
LELLEDQSDIVSTADHYYAAF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_780569
Locus ID 108689
UniProt ID Q8K2X3
Refseq Size 1878
Cytogenetics 19 C3
Refseq ORF 1113
Synonyms 0610009H20Rik; 2310057J23Rik; AAF-44; AAF44; AI413458; Obfc1; RPA-32
Summary Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation (PubMed:19854130). However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha (PubMed:22748632). The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins. Required for efficicient replication of the duplex region of the telomere. Promotes efficient replication of lagging-strand telomeres. Promotes general replication start following replication-fork stalling implicating new origin firing. May be in involved in C-strand fill-in during late S/G2 phase independent of its role in telomere duplex replication (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...