Rnf34 (NM_030564) Mouse Recombinant Protein

CAT#: TP505854

Purified recombinant protein of Mouse ring finger protein 34 (Rnf34), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205854 protein sequence
Red=Cloning site Green=Tags(s)

MKAGATSMWASCCGLLNEVMGTGAVRGQQAGFPGSTGPFRFTPSSDFPTYPPAATEGPNIVCKACGLSFS
VFRKKHVCCDCKKDFCSLCSVSQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLLLRNIPTDTCREK
EDLVDLVLCHRGLGSGDDLDSSSLNSSRSQTSSFFTQSLFSNYTPPSATVSSFQGELMDRDGAFRSEVLA
QVQSEIASANTDDDDDDDDDDDDDEDDDDEQEEEEQNPGLSKKKARASLSDLSSLEEVEGMSVRQLKEIL
ARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERMQLQDEEDDSLCRICMDAVIDCVLLECGHMVTC
TKCGKRMSECPICRQYVVRAVHVFKS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_085041
Locus ID 80751
UniProt ID Q99KR6
Refseq Size 1980
Cytogenetics 5 F
Refseq ORF 1128
Synonyms AW061037; AW536122; BC004042; C88279; RIFF
Summary E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis. May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway. Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation. Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN. Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...