Hsd3b1 (NM_008293) Mouse Recombinant Protein
CAT#: TP505766
Purified recombinant protein of Mouse hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 (Hsd3b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205766 protein sequence
Red=Cloning site Green=Tags(s) MAGWSCLVTGAGGFVGQRIIKMLVQEKELQEVRALDKVFRPETKEEFSKLQTKTKVTVLEGDILDAQCLR RACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACVQASVPAFIFCSSVDAAGPNSYKKIVLN GHEEQNHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLNTCALRPMYIYGERSPFIFNAIIRALKNKG ILCVTGKFSIANPVYVENVAWAHILAARGLRDPKKSTSIQGQFYYISDDTPHQSYDDLNYTLSKEWGLRP NASWSLPLPLLYWLAFLLETVSFLLRPVYRYRPLFNRHSITLSNSTFTFSYKKAQRDLGYEPLVNWEEAK QKTSEWIGTIVEQHREILDTKCQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 42 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_032319 |
| Locus ID | 15492 |
| UniProt ID | P24815 |
| Refseq Size | 1852 |
| Cytogenetics | 3 42.89 cM |
| Refseq ORF | 1119 |
| Synonyms | 3-beta-HSD I; D3Ertd383e |
| Summary | A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. Specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Expected to use NAD(+) as preferred electron donor for the 3-beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
