Aspn (NM_025711) Mouse Recombinant Protein

CAT#: TP505760

Purified recombinant protein of Mouse asporin (Aspn), transcript variant 1,full length with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
现货

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205760 protein sequence
Red=Cloning site Green=Tags(s)

MKEYVMLLLLAVCSAKPFFSPSHTALKNMMLKDMEDTDDDDNDDDDNSLFPTKEPVNPFFPFDLFPTCPF
GCQCYSRVVHCSDLGLTSVPNNIPFDTRMVDLQNNKIKEIKENDFKGLTSLYALILNNNKLTKIHPKTFL
TTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSANPLENNGIEPGAF
EGVTVFHIRIAEAKLTSIPKGLPPTLLELHLDFNKISTVELEDLKRYRELQRLGLGNNRITDIENGTFAN
IPRVREIHLEHNKLKKIPSGLQELKYLQIIFLHYNSIAKVGVNDFCPTVPKMKKSLYSAISLFNNPMKYW
EIQPATFRCVLGRMSVQLGNVGK

myc-FLAG tag
Tag Myc-DDK
Predicted MW 42.6 kDa
Concentration >0.05 µg/µL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079987.2
Locus ID 66695
UniProt ID Q99MQ4
Refseq Size 2362
Cytogenetics 13 A5
Refseq ORF 1119
Synonyms 4631401G09Rik; AA986886; PL; Plap1; SL; Slrr1c
Summary This gene encodes a member of the small leucine-rich proteoglycan family. The encoded protein is an extracellular matrix protein that modulates the transforming growth factor-beta signaling pathway, regulating cartilage matrix gene expression and cartilage formation. The protein plays a role in the pathology of osteoarthritis. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...