St13 (NM_133726) Mouse Recombinant Protein

CAT#: TP505726

Purified recombinant protein of Mouse suppression of tumorigenicity 13 (St13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205726 protein sequence
Red=Cloning site Green=Tags(s)

MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKRDKTTEENIKT
EELSSEESDLEIDNEGVIEPDTDAPQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAI
KLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKL
DYDEDASAMLREVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGSQYGSF
PGGFPGGMPGNFPGGMPGMGGAMPGMAGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKY
QSNPKVMNLISKLSAKFGGQS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598487
Locus ID 70356
UniProt ID Q99L47
Refseq Size 1622
Cytogenetics 15 E1
Refseq ORF 1113
Synonyms 1110007I03Rik; 3110002K08Rik; AW555194; HIP; HOP; HSPABP; HSPABP1; p48; PRO0786; SNC6
Summary One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...