Macroh2a1 (NM_001159515) Mouse Recombinant Protein
CAT#: TP505680
Purified recombinant protein of Mouse H2A histone family, member Y (H2afy), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205680 protein sequence
Red=Cloning site Green=Tags(s) MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARD NKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPS QKKPVAKKTGGKKGARKSKKKQGEVSKAASADSTTEGTPTDGFTVLSTKSLFLGQKLQVVQADIASIDSD AVVHPTNTDFYTGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHCNSPVWGA DKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFML FDSESIGIYVQEMAKLDAN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001152987 |
Locus ID | 26914 |
UniProt ID | Q9QZQ8 |
Refseq Size | 1966 |
Cytogenetics | 13 B1 |
Refseq ORF | 1107 |
Synonyms | H2af; H2AF12; H2AF12M; H2afy; MACROH2; mH2a; mH2a1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
其它Macroh2a1产品