Mrg2 (BC003762) Mouse Recombinant Protein
CAT#: TP505536
Purified recombinant protein of Mouse myeloid ecotropic viral integration site-related gene 2 (cDNA clone MGC:5914 IMAGE:3593200), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205536 protein sequence
Red=Cloning site Green=Tags(s) MARRYDELRHYPGITEHMTALASFSEAAPSVPRAPGPYTPHRPPQLQAPGLDSDSLKREKDDIYGHPLFP LLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAI QVLRFHLLELEKGKMPIDLVIEDRDGSCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGG LASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQ KKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQPMAGFTETQPQVTVRTPGSMGM NLNLEGEWHYL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 39.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 17537 |
| UniProt ID | P97368 |
| Refseq Size | 1721 |
| Cytogenetics | 7 8.76 cM |
| Refseq ORF | 1083 |
| Synonyms | Meis3 |
| Summary | The protein encoding this gene belongs to the three amino acid loop extension family of homeodomain transcription factors, which play essential roles in many embryonic processes. These proteins are characterized by an atypical homeodomain containing a three amino acid loop extension between helices 1 and 2. Expression of this gene begins during the compaction stage of embryogenesis and continues into the blastocyst stage. This gene is also expressed in pancreatic islet cells and beta-cells and regulates beta-cell survival. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Documents
| FAQs |
| SDS |
