Hmces (NM_173737) Mouse Recombinant Protein

CAT#: TP505366

Purified recombinant protein of Mouse 5-hydroxymethylcytosine (hmC) binding, ES cell specific (Hmces), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
HMCES Antibody - N-terminal region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205366 protein sequence
Red=Cloning site Green=Tags(s)

MCGRTSCHLPREVLTRACAYQDRQGRRRLPQWRDPDKYCPSYNKSPQSSSPVLLSRLHFEKDADSSDRII
IPMRWGLVPSWFKESDPSKLQFNTTNCRSDTIMEKQSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPY
FIYFPQIKTEKSGGNDASDSSDNKEKVWDNWRLLTMAGIFDCWEAPGGECLYSYSIITVDSCRGLSDIHS
RMPAILDGEEAVSKWLDFGEVATQEALKLIHPIDNITFHPVSPVVNNSRNNTPECLAPADLLVKKEPKAN
GSSQRMMQWLATKSPKKEVPDSPKKDASGLPQWSSQFLQKSPLPAKRGATSSFLDRWLKQEKEDEPMAKK
PNS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_776098
Locus ID 232210
UniProt ID Q8R1M0
Refseq Size 1422
Cytogenetics 6 D1
Refseq ORF 1059
Synonyms 8430410A17Rik; C85376
Summary Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites (By similarity). Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA (By similarity). The HMCES DNA-protein cross-link is then degraded by the proteasome (By similarity). Promotes error-free repair of abasic sites by acting as a 'suicide' enzyme that is degraded, thereby protecting abasic sites from translesion synthesis (TLS) polymerases and endonucleases that are error-prone and would generate mutations and double-strand breaks (By similarity). Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine (PubMed:29020633). Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells (PubMed:23434322). May act as an endonuclease that specifically cleaves 5hmC-containing DNA; additional experiments are however required to confirm this activity in vivo (PubMed:29020633).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...