Dtnbp1 (NM_025772) Mouse Recombinant Protein

CAT#: TP505351

Purified recombinant protein of Mouse dystrobrevin binding protein 1 (Dtnbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205351 protein sequence
Red=Cloning site Green=Tags(s)

MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKGKPRTAPRLPKYSAGLELLSRYEDAWAALHRRAKECA
DAGELVDSEVVMLSAHWEKKRTSLNELQGQLQQLPALLQDLESLMASLAHLETSFEEVENHLLHLEDLCG
QCELERHKQAQAQHLESYKKSKRKELEAFKAELDTEHTQKALEMEHTQQLKLKERQKFFEEAFQQDMEQY
LSTGYLQIAERREPMGSMSSMEVNVDVLEQMDLMDISDQEALDVFLNSGGEDNIVMSPGVEMESNPNQNE
MSLQIPSPSESASQPPASPSACTDLDTADAPLIQSDEEEVQVDTALVTLHTDRKSTPGVSDDSDQCDSTQ
DI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 39.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080048
Locus ID 94245
UniProt ID Q91WZ8
Refseq Size 1311
Cytogenetics 13 21.73 cM
Refseq ORF 1056
Synonyms 5430437B18Rik; AW048963; Bloc1s8; dysbindin; sdy
Summary Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Associates with the BLOC-2 complex to facilitate the transport of TYRP1 independent of AP-3 function. Plays a role in synaptic vesicle trafficking and in neurotransmitter release. Plays a role in the regulation of cell surface exposure of DRD2. May play a role in actin cytoskeleton reorganization and neurite outgrowth. May modulate MAPK8 phosphorylation. Appears to promote neuronal transmission and viability through regulating the expression of SNAP25 and SYN1, modulating PI3-kinase-Akt signaling and influencing glutamatergic release. Regulates the expression of SYN1 through binding to its promoter. Modulates prefrontal cortical activity via the dopamine/D2 pathway.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...