Atp6v0d2 (NM_175406) Mouse Recombinant Protein
CAT#: TP505301
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V0 subunit D2 (Atp6v0d2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205301 representing NM_175406
Red=Cloning site Green=Tags(s) MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLANETNPLTVSKI DTEMRKKLCREFDYFRNHSLEPLSTFLTYMTCSYMIDNIILLMNGALQKKSVKEVLAKCHPLGRFTEMEA VNIAETPSDLFKAVLVETPLAPFFQDCMSENTLDELNIELLRNKLYKSYLEAFYKFCKDHGDVTADVMCP ILEFEADRRALIITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNYGVYKPLFDA VGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 40.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_780615 |
| Locus ID | 242341 |
| UniProt ID | Q80SY3 |
| Refseq Size | 2518 |
| Cytogenetics | 4 A3 |
| Refseq ORF | 1050 |
| Synonyms | 1620401A02Rik; AI324824; V-ATPase |
| Summary | Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity). May play a role in coupling of proton transport and ATP hydrolysis. Regulator of osteoclast fusion and bone formation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Atp6v0d2产品
