Noxo1 (NM_027988) Mouse Recombinant Protein

CAT#: TP505276

Purified recombinant protein of Mouse NADPH oxidase organizer 1 (Noxo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
NOXO1 Antibody - N-terminal region
    • 50 ug

CNY 4628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205276 protein sequence
Red=Cloning site Green=Tags(s)

MASPRHPVSAHAVALVQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRRSEQVL
PKLPDAPLLTRRGHTGRGLVRLRLLDTYVQALLATSEHILRSSALHGFFVPKPLDLEPMLPPGSLVILPT
PEEPLSQPRGSLDIHSLEAQSIPCVQPFHTLDIRDRPFHTKAQEILDILLRHPSGWWLVENKDQQVAWFP
APYLEEVATCQGQESGLALQGSGRQFCTTQAYEGSRSDELSVPSGARVHVLETSDRGWWLCRYNGRTGLL
PAMSLQPEGLGSLLGRPGFPDSAGADKVAEDRTIPPVVPTRPCMSAIQSRCCSITRRALAQEQGTRVPR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082264
Locus ID 71893
UniProt ID Q8VCM2
Refseq Size 2239
Cytogenetics 17 12.49 cM
Refseq ORF 1047
Synonyms 2310034C04Rik; hslt; P41NOX; P41NOXA; P41NOXB; P41NOXC; Snx28
Summary Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...