Zfyve27 (NM_177319) Mouse Recombinant Protein

CAT#: TP505235

Purified recombinant protein of Mouse zinc finger, FYVE domain containing 27 (Zfyve27), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205235 representing NM_177319
Red=Cloning site Green=Tags(s)

MQTSDRDLSGPEASPSGMPEVLSECPPAPTKSAAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP
LCSLLTCLGLNILFLTLNEGAWYSMGALMISVPALLGYLQEVCRGQLPESELMRRKYHSIRQEDLQRVRL
SRVHLSRPEAVAEVKSFLIQLEAFLARLCYTCESAYRVLHWENPVVSSQFYGALLGMVCMLYLLPLCWVL
ALLNSTLFLGNGDFFRVVCEYRACLQRRMNPRQEECACESSALQGAGGRGLLDSSPAPTPTEDLTPGSVE
EAEEAEPDEEFKDAIEETHLVVLEDEEGTPCPAEDELTLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNN
FGNCAGCAATFSVLKKRRSCSNCGNSFCSRCCSFKVPRSSMGATAPEAQRETVCVCASCNQTLSK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_796293
Locus ID 319740
UniProt ID Q3TXX3
Refseq Size 5636
Cytogenetics 19 C3
Refseq ORF 1245
Synonyms 2210011N02Rik; 9530077C24Rik; AI426636; AI593546; AI835681
Summary Key regulator of RAB11-dependent vesicular trafficking during neurite extension through polarized membrane transport (By similarity). Promotes axonal elongation and contributes to the establishment of neuronal cell polarity (PubMed:24251978). Involved in nerve growth factor-induced neurite formation in VAPA-dependent manner. Contributes to both the formation and stabilization of the tubular ER network. Involved in ER morphogenesis by regulating the sheet-to-tubule balance and possibly the density of tubule interconnections (By similarity). Acts as an adapter protein that facilitates the interaction of KIF5A with VAPA, VAPB, SURF4, RAB11A, RAB11B and RTN3 and the ZFYVE27-KIF5A complex contributes to the transport of these proteins in neurons. Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a KIF5A/B-dependent manner (PubMed:21976701).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...