Slc25a33 (NM_027460) Mouse Recombinant Protein
CAT#: TP505182
Purified recombinant protein of Mouse solute carrier family 25, member 33 (Slc25a33), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205182 protein sequence
Red=Cloning site Green=Tags(s) MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV TPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGVFVPNSNTVHILSAGSAAF VTNTLMNPIWMVKTRMQLERKVRGCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESL KKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFR EEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 35 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_081736 |
| Locus ID | 70556 |
| UniProt ID | Q3TZX3 |
| Refseq Size | 1877 |
| Cytogenetics | 4 E2 |
| Refseq ORF | 960 |
| Synonyms | 5730438N18Rik; Pnc1 |
| Summary | Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Transports preferentially uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism. Also transports guanine but not adenine (deoxy)nucleotides. Is inhibited strongly by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, mersalyl acid, p-hydroxymercuribenzoate). Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration (By similarity). Upon INS or IGF1 stimulation regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, the ratio of mitochondria-to nuclear-encoded components of the electron transport chain resulting in control of mitochondrial ROS production (PubMed:17596519). Participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Slc25a33产品
