Qk (NM_001159517) Mouse Recombinant Protein

CAT#: TP505120

Purified recombinant protein of Mouse quaking (Qk), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205120 protein sequence
Red=Cloning site Green=Tags(s)

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001152989
Locus ID 19317
UniProt ID Q9QYS9
Refseq Size 4658
Cytogenetics 17 7.75 cM
Refseq ORF 1023
Synonyms 1110003F05Rik; 1500005P18; l(17)-1Wis; l17Wis1; QkI
Summary RNA-binding protein that plays a central role in myelinization (PubMed:10864952, PubMed:11917126). Also required for visceral endoderm function and blood vessel development (PubMed:11892011, PubMed:16470614). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence (PubMed:16041388). Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation, as well as cellular processes including apoptosis, cell cycle, glial cell fate and development (PubMed:10535969, PubMed:12467586, PubMed:11297509, PubMed:11917126, PubMed:15568022). Required to protect and promote stability of mRNAs such as MBP and CDKN1B which promotes oligodendrocyte differentiation (PubMed:10535969, PubMed:15568022). Participates in mRNA transport by regulating the nuclear export of MBP mRNA (PubMed:12467586). May also play a role in smooth muscle development (PubMed:14706070).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...