Angptl7 (NM_001039554) Mouse Recombinant Protein
CAT#: TP505028
Purified recombinant protein of Mouse angiopoietin-like 7 (Angptl7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR205028 representing NM_001039554
Red=Cloning site Green=Tags(s) MLRETWLCVILVAFVSHPVWLQKPHKRKTQLKAAGCCEEMRELKAQVANLSSLLGELSRKQESDWVSVVM QVMELESSSKHMESRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPP DEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWLGNEHIHRLTRQPSRL RVELEDWEGNARYAEYSYFALGNELNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDKCAQLR KGGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWYGWHGANYSLKRVEMKIRPEAFKP myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 39.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001034643 |
| Locus ID | 654812 |
| UniProt ID | Q8R1Q3 |
| Refseq Size | 2063 |
| Cytogenetics | 4 E2 |
| Refseq ORF | 1011 |
| Summary | Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (By similarity). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Angptl7产品
