Parp16 (NM_177460) Mouse Recombinant Protein

CAT#: TP504648

Purified recombinant protein of Mouse poly (ADP-ribose) polymerase family, member 16 (Parp16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204648 protein sequence
Red=Cloning site Green=Tags(s)

MQLSNRAAAREAASRDVLAADLRCSLFASALQSYKRDSVLRPFPASYARHDCKDFEALLADTGRLPNLKE
LLQSSRDTDKQAWDLVSWILSSKILTIHSAKKAEFEKIQQLTGAPHTPVPTPDFLFEIEYFDPANSRFYE
TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS
CVAVCEVIDHPDVKCQIKKKDSKEIDRSRARIKHSEGGEIPPKYFVVTNNQLLRVKYLLVYSQKQPKRAS
SQLSWLSSHWFVIMMSLYLLLLLIVSVTNSSAFHHFWNRVKR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_803411
Locus ID 214424
UniProt ID Q7TMM8
Refseq Size 2483
Cytogenetics 9 C
Refseq ORF 966
Synonyms ARTD15; BC055447; C79952; PARP-16
Summary Intracellular mono-ADP-ribosyltransferase that may play a role in different processes through the mono-ADP-ribosylation of proteins involved in those processes. May play a role in the unfolded protein response (UPR), by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors. May also mediate mono-ADP-ribosylation of karyopherin KPNB1 a nuclear import factor. May not modify proteins on arginine or cysteine residues compared to other mono-ADP-ribosyltransferases.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...