Rhbdd1 (NM_029777) Mouse Recombinant Protein

CAT#: TP504515

Purified recombinant protein of Mouse rhomboid domain containing 1 (Rhbdd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204515 protein sequence
Red=Cloning site Green=Tags(s)

MQRRTRGINTGLLLLLSQVFQIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCYQQKDWQRLLL
SPLHHGDDWHLYFNMVSMLWKGVKLERRLGSRWFAYVIATFSLLTGVVYLLLQFTVAELMNQPDFKRNCA
VGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAELVAIHFCTPGTSFAGHLAGILVGLMYTQGPL
KKIMDMCAGIFISHSGPSGQQNHFNNAGPSGYQNHYADGRPVTYDATYRNYDVYTAGLSEEEQLERALRA
SIWDRGNTRNGPMPYGFRLPPEEMRRQRLHRFDGQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084053
Locus ID 76867
UniProt ID Q8BHC7
Refseq Size 3533
Cytogenetics 1 C5
Refseq ORF 945
Synonyms 4930418P06Rik; mRHBDD1; RRP4
Summary Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...