Wdr83 (NM_026399) Mouse Recombinant Protein

CAT#: TP504507

Purified recombinant protein of Mouse WD repeat domain containing 83 (Wdr83), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204507 protein sequence
Red=Cloning site Green=Tags(s)

MAFPEPKPRAPELPQKRMKTLDCSQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV
LDAAGSFDNSHLCSGGGDKTVVLWDVATGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSVRCWDCRS
RKPEPVQTLDEARDGISSVKVSDHEILAGSVDGRVRRYDLRMGQVSSDYVGGPITCTCFSRDGQCTLISS
LDSTLRLLDKDTGELLGEYVGHKNQQYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSNVV
QSLAYHPTEPCLLTAMGGSIQYWREETYEAEGGAG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080675
Locus ID 67836
UniProt ID Q9DAJ4
Refseq Size 1238
Cytogenetics 8 C3
Refseq ORF 945
Synonyms 1500041N16Rik; Morg1
Summary Molecular scaffold protein for various multimeric protein complexes. Involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). Also acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. May also be involved in pre-mRNA splicing.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...