Epsti1 (NM_029495) Mouse Recombinant Protein

CAT#: TP504486

Purified recombinant protein of Mouse epithelial stromal interaction 1 (breast) (Epsti1), transcript variant a, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204486 protein sequence
Red=Cloning site Green=Tags(s)

MYTRSKVVGPGLGTSSISRDHAGAGQRRELGLQQNRRQSLEVAAPEGPKMERQGHADQGSAGTYTLIAPN
ESRRQKIQRIAEQELADLERWKQQNRAKPVYLVPQRLGGSQSEAEVRQKQQLQQMRSKYQQKLKRDESIR
IRKEAEEAKFQKMKAIQREKSNKLEEKKQLQEDIRRATFREHHQSKTAELLSRLDTERRNRSACLIAPPA
TQSSRWKLPVLLRDPSWAGSQAHRDSPQKEDNPRLQKTRDGHQKNKLLETKGQHQEEERAQIHQAEHWRV
NNAFLDRLQGKSQPGGLEQSGGCCNMNSTDSWGI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083771
Locus ID 108670
UniProt ID Q8VDI1
Refseq Size 1869
Cytogenetics 14 D3
Refseq ORF 942
Synonyms 2310046K10Rik; 5033415K03Rik; BRESI1
Summary Plays a role in M1 macrophage polarization and is required for the proper regulation of gene expression during M1 versus M2 macrophage differentiation (PubMed:29217193). Might play a role in RELA/p65 and STAT1 phosphorylation and nuclear localization upon activation of macrophages (PubMed:29217193).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...