Vta1 (NM_025418) Mouse Recombinant Protein

CAT#: TP504382

Purified recombinant protein of Mouse vesicle (multivesicular body) trafficking 1 (Vta1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204382 protein sequence
Red=Cloning site Green=Tags(s)

MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL
KKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK
HRKYARWKATYIHNCLKNGETPQAGPVGIEEENDVEENEDVGATSLPTQPPQPSSSSAYDPSNLAPGSYS
GIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQTVPAAPAVDPDLYTASQGDIRLTPEDFARAQKYCKY
AGSALQYEDVGTAVQNLQKALRLLTTGRE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079694
Locus ID 66201
UniProt ID Q9CR26
Refseq Size 1343
Cytogenetics 10 A2
Refseq ORF 927
Synonyms 1110001D18Rik; 1110059P08Rik; AU040813; C85340; LIP5; SBP1
Summary Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies (By similarity). Involved in the sorting and down-regulation of EGFR.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...