Rtf2 (NM_025542) Mouse Recombinant Protein

CAT#: TP504324

Purified recombinant protein of Mouse replication termination factor 2 (Rtf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204324 protein sequence
Red=Cloning site Green=Tags(s)

MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKDAVIEFLLDKS
AEKALGKAASHIRSIKNVTELRLSDNPAWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCC
GCVFSERALKEIKAEVCHTCGAAFQEEDIIVLNGTKEDVEMLKKRMEERRLRAKLEKKTKKPKTATECAS
KPGTTQDSAGPSKVKSGKPEEADPDPREKKSTPAPRGAATNGSASGKVGKPPCGALKRSIADSEESETYK
SIFTSHSSAKRSKEESAHWVTHTSYCF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079818
Locus ID 66404
UniProt ID Q99K95
Refseq Size 2142
Cytogenetics 2 H3
Refseq ORF 921
Synonyms 1700067C04Rik; 2410001C21Rik; 5730427M17Rik; AA589417
Summary Replication termination factor which is a component of the elongating replisome. Required for ATR pathway signaling upon DNA damage and has a positive activity during DNA replication. Might function to facilitate fork pausing at replication fork barriers like the rDNA. May be globally required to stimulate ATR signaling after the fork stalls or encounters a lesion. Interacts with nascent DNA.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...