Ldlrad4 (NM_172631) Mouse Recombinant Protein

CAT#: TP504315

Purified recombinant protein of Mouse low density lipoprotein receptor class A domain containing 4 (Ldlrad4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204315 protein sequence
Red=Cloning site Green=Tags(s)

MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNSELEFAQILI
IVVVVTVMVVVVVCLLNHYKVSTRSFINRPNQSQRQEDGLQPEGSLWPSDSSVQRPGASEIMCAPRGRDR
FTTPSFIQRDPFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPN
RTVFDSDLIDISMYNGGPCPPSSHSGISAATCSSNGRMEGPPPTYSEVMGHYPGTSFFHHQHSNTHRGSR
PQFQPNNSEGTIVPIKGKDRKPGDLV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_766219
Locus ID 52662
UniProt ID Q8BWJ4
Refseq Size 2493
Cytogenetics 18 40.14 cM
Refseq ORF 918
Synonyms 8230401C20Rik; A430083H02; A430108L08Rik; C18orf1; D18Ertd653e; D330030L18Rik
Summary Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...