Ldlrad4 (NM_172631) Mouse Recombinant Protein
CAT#: TP504315
Purified recombinant protein of Mouse low density lipoprotein receptor class A domain containing 4 (Ldlrad4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204315 protein sequence
Red=Cloning site Green=Tags(s) MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNSELEFAQILI IVVVVTVMVVVVVCLLNHYKVSTRSFINRPNQSQRQEDGLQPEGSLWPSDSSVQRPGASEIMCAPRGRDR FTTPSFIQRDPFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPN RTVFDSDLIDISMYNGGPCPPSSHSGISAATCSSNGRMEGPPPTYSEVMGHYPGTSFFHHQHSNTHRGSR PQFQPNNSEGTIVPIKGKDRKPGDLV myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 33.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_766219 |
| Locus ID | 52662 |
| UniProt ID | Q8BWJ4 |
| Refseq Size | 2493 |
| Cytogenetics | 18 40.14 cM |
| Refseq ORF | 918 |
| Synonyms | 8230401C20Rik; A430083H02; A430108L08Rik; C18orf1; D18Ertd653e; D330030L18Rik |
| Summary | Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Ldlrad4产品
