Stk16 (NM_011494) Mouse Recombinant Protein

CAT#: TP504293

Purified recombinant protein of Mouse serine/threonine kinase 16 (Stk16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204293 protein sequence
Red=Cloning site Green=Tags(s)

MGHALCVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQEEAQREAEMHR
LFQHPNILRLMAYSLKERGAKHEAWLLLPFFKKGTLWNEIERLKDQGSFLTEDQILPLLLGISRGLEAIH
AKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHC
VIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNELSIPQSPRHSSALRQLLSSMMTVDPQQR
PHIPVLLSQLEALQPPAPGQHTTQI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035624
Locus ID 20872
UniProt ID O88697
Refseq Size 2885
Cytogenetics 1 C4
Refseq ORF 915
Synonyms EDPK; Krct; MPSK; PKL12; TSF-1
Summary Membrane-associated protein kinase that phosphorylates on serine and threonine residues. In vitro substrates include DRG1, ENO1 and EIF4EBP1. Also autophosphorylates (By similarity). May be involved in secretory vesicle trafficking or intracellular signaling. May have a role in regulating stromal-epithelial interactions that occur during ductal morphogenesis in the mammary gland. May be involved in TGF-beta signaling. Able to autophosphorylate on Tyr residue; it is however unclear whether it has tyrosine-protein kinase toward other proteins.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...