Sult1b1 (NM_019878) Mouse Recombinant Protein
CAT#: TP504165
Purified recombinant protein of Mouse sulfotransferase family 1B, member 1 (Sult1b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204165 protein sequence
Red=Cloning site Green=Tags(s) MSASEDVWRKDLKMIHGYPMIYAFALNWERIEEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKC KRDVITSKVPMLELSVPGIRISGVELLKKTPSPRIIKTHLPIDLLPKSFWENKCKMIYLARNGKDVAVSY YHFDLMNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIAS FLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAV YKKKMSGTTLEFCTDIQSA myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 34.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_063931 |
| Locus ID | 56362 |
| UniProt ID | Q9QWG7 |
| Refseq Size | 2604 |
| Cytogenetics | 5 E1 |
| Refseq ORF | 897 |
| Synonyms | ST1B1; St2b2 |
| Summary | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates L-DOPA and D-DOPA, tyrosine isomers such as DL-m-tyrosine, dopamine and thyroid hormones.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Sult1b1产品
