Sult1b1 (NM_019878) Mouse Recombinant Protein

CAT#: TP504165

Purified recombinant protein of Mouse sulfotransferase family 1B, member 1 (Sult1b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204165 protein sequence
Red=Cloning site Green=Tags(s)

MSASEDVWRKDLKMIHGYPMIYAFALNWERIEEFQSTPGDIVITTYPKSGTTWLSEIVDMVLNDGNVEKC
KRDVITSKVPMLELSVPGIRISGVELLKKTPSPRIIKTHLPIDLLPKSFWENKCKMIYLARNGKDVAVSY
YHFDLMNSINPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREEHPLLYLYYEELKQNPKKEIKKIAS
FLDKTLDEEALDRIVHHTSFEMMKENPLVNYTHLPTAMMDHSKSPFMRKGIVGDWKNYFTMTQTEQFDAV
YKKKMSGTTLEFCTDIQSA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_063931
Locus ID 56362
UniProt ID Q9QWG7
Refseq Size 2604
Cytogenetics 5 E1
Refseq ORF 897
Synonyms ST1B1; St2b2
Summary Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates L-DOPA and D-DOPA, tyrosine isomers such as DL-m-tyrosine, dopamine and thyroid hormones.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...