AI118078 (BC068128) Mouse Recombinant Protein
CAT#: TP504132
Purified recombinant protein of Mouse expressed sequence AI118078 (cDNA clone MGC:92972 IMAGE:6835202), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204132 protein sequence
Red=Cloning site Green=Tags(s) MMLFQPHRAFRSDWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDTKLLQFSNAFQFA GVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLII MFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA EREAALQAPHVLSQPRSRYKVVEAGTWAEETAAESIVEELRPSQEATVKDDMNSYISQYYNGPSSGKSGL GLFACTMQPQDTCDPSKP myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 33.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 244886 |
| UniProt ID | Q8BZB3 |
| Refseq Size | 4432 |
| Cytogenetics | 9 B |
| Refseq ORF | 894 |
| Synonyms | 9630029F15; AI118078; HVRP1 |
| Summary | Voltage-sensor protein present on the post-synaptic side of glutamatergic mossy fibers and granule cells in the cerebellum. Despite the presence of a voltage-sensor segment, does not form a functional ion channel and its precise role remains unclear. Undergoes both rapid and slow structural rearrangements in response to changes in voltage. Contains a zinc-binding site that can regulate the slow conformational transition.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它AI118078产品
