Cfdp1 (NM_011801) Mouse Recombinant Protein

CAT#: TP504085

Purified recombinant protein of Mouse craniofacial development protein 1 (Cfdp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204085 protein sequence
Red=Cloning site Green=Tags(s)

MEEFDSEDFSTSDEDEDYLPSGGEYSEDDVNELVKEDEVDGEEQAEKTKGKRRKAQGIPARKRKQSGLLL
EEEEDGKEDSGGSSSEEDEEEQEGGLGSENARKKKEDELWASFLNDVGPKSKAAPGSQTKVAEETEEISS
NKPLVKADELDKPRESEKVKITKVFDFAGEEVRVTKEVDAASKEAKSFLKQTEREKPQALVTSPATPLPA
GSGIKRASGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHR
QFEIERDLRLSKMKP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035931
Locus ID 23837
UniProt ID O88271
Refseq Size 1215
Cytogenetics 8 E1
Refseq ORF 885
Synonyms AA408409; Bcnt; Bucentaur; Cfdp; cp27
Summary May play a role during embryogenesis. May modulate tooth organogenesis since alterations of this protein function affect tooth organs size as well as individual cell fate and survival. In embryonic cells, blockage of the function results in increased number of apoptotic cells, reduced proliferation, alterations in cell shape and fibronection matrix synthesis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...