Otud6b (NM_152812) Mouse Recombinant Protein

CAT#: TP504060

Purified recombinant protein of Mouse OTU domain containing 6B (Otud6b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204060 protein sequence
Red=Cloning site Green=Tags(s)

MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQL
KQLTFKDSKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLA
QILAARELEIKQIPSDGHCMYGALEDQLREQDCALTVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTP
EEFGKYCDDIVNTAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYN
SVTRLVNSATENCS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 33.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_690025
Locus ID 72201
UniProt ID Q8K2H2
Refseq Size 3311
Cytogenetics 4 A1
Refseq ORF 882
Synonyms 2600013N14Rik; AU015433
Summary Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 (By similarity). May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation (By similarity). May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation (By similarity). May also play a role in proteasome assembly and function (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...