Marchf8 (NM_027920) Mouse Recombinant Protein
CAT#: TP503891
Purified recombinant protein of Mouse membrane-associated ring finger (C3HC4) 8 (March8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203891 protein sequence
Red=Cloning site Green=Tags(s) MSMPLHQISAIPSQDAISARVYRSKTKDKEQNEKTLGHSMSHPSNISKAGSSPPSTTAPVSAFSRTSVTP SNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEK LQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQVTGILEWPFWTKLVVVAIGFTGGLLF MYVQCKVYLQLWKRLKAYNRVIYVQNCPETSKKNIFEKSALTEPTLENKEGHGMCHSTTNSSCTEPEDTG AEIINV myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 32.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_082196 |
| Locus ID | 71779 |
| UniProt ID | Q9DBD2 |
| Refseq Size | 4521 |
| Cytogenetics | 6 E3 |
| Refseq ORF | 858 |
| Synonyms | 1300017E09Rik; M; Marc; MARCH-VIII; March8; Mir |
| Summary | The protein encoded by this gene is a member of the membrane-associated really interesting new gene-CH family of proteins. These proteins are E3 ubiquitin-protein ligases that modulate antigen presentation by downregulating major histocompatibility complex class II surface expression through endocytosis. The transcript is primarily expressed by dendritic cells and macrophages. Overexpression of this gene in antigen presenting cells results in immune defective phenotypes, including resistance to autoimmune disease onset. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Documents
| FAQs |
| SDS |
其它Marchf8产品
