Tia1 (BC023813) Mouse Recombinant Protein
CAT#: TP503884
Purified recombinant protein of Mouse cytotoxic granule-associated RNA binding protein 1 (cDNA clone MGC:36034 IMAGE:5353938), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203884 protein sequence
Red=Cloning site Green=Tags(s) MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK IMGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGF VSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGV TSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRQTQSSAPWMGPNYSVPPPQGQNGSMLPSQPAGYRVA GYETQ myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 31.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 21841 |
| UniProt ID | P52912 |
| Refseq Size | 1455 |
| Cytogenetics | 6 D1 |
| Refseq ORF | 855 |
| Synonyms | 2310050N03Rik; AI256674; mTIA-1; TIA-1 |
| Summary | Involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
