Xpa (BC029241) Mouse Recombinant Protein
CAT#: TP503762
Purified recombinant protein of Mouse xeroderma pigmentosum, complementation group A (cDNA clone MGC:36016 IMAGE:4489063), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203762 representing BC029241
Red=Cloning site Green=Tags(s) MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVASVKAAPKMID TKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITK TEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENR EKMKQKKFDKKVKVGLDDAVKILLDDKPLHRMAPWHNRALEKRSSVLTRTTTKQISFIYSINTCDCCAK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 45.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 22590 |
| UniProt ID | Q64267 |
| Refseq Size | 1234 |
| Cytogenetics | 4 24.49 cM |
| Refseq ORF | 837 |
| Synonyms | AI573865; Xpac |
| Summary | Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
