Entpd6 (BC038126) Mouse Recombinant Protein
CAT#: TP503750
Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 6 (cDNA clone MGC:47939 IMAGE:1348160), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203750 protein sequence
Red=Cloning site Green=Tags(s) MRKIPNHGTLRMTKVAYPLGLCVGLFIYVAYIKWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGH EVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIP YDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGS LKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYRWVCSRLAPPTDAS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 30.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 12497 |
UniProt ID | Q3U0P5 |
Refseq Size | 1200 |
Cytogenetics | 2 G3 |
Refseq ORF | 834 |
Synonyms | 2700026H11Rik; Cd39l2; NTPDase-6 |
Summary | Catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. Has a strong preference for nucleoside diphosphates, preferentially hydrolyzes GDP, IDP, and UDP, with slower hydrolysis of CDP, ITP, GTP, CTP, ADP, and UTP and virtually no hydrolysis of ATP. The membrane bound form might support glycosylation reactions in the Golgi apparatus and, when released from cells, might catalyze the hydrolysis of extracellular nucleotides.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |