Entpd6 (BC038126) Mouse Recombinant Protein

CAT#: TP503750

Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 6 (cDNA clone MGC:47939 IMAGE:1348160), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203750 protein sequence
Red=Cloning site Green=Tags(s)

MRKIPNHGTLRMTKVAYPLGLCVGLFIYVAYIKWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGH
EVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIP
YDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGS
LKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYRWVCSRLAPPTDAS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 12497
UniProt ID Q3U0P5
Refseq Size 1200
Cytogenetics 2 G3
Refseq ORF 834
Synonyms 2700026H11Rik; Cd39l2; NTPDase-6
Summary Catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. Has a strong preference for nucleoside diphosphates, preferentially hydrolyzes GDP, IDP, and UDP, with slower hydrolysis of CDP, ITP, GTP, CTP, ADP, and UTP and virtually no hydrolysis of ATP. The membrane bound form might support glycosylation reactions in the Golgi apparatus and, when released from cells, might catalyze the hydrolysis of extracellular nucleotides.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...