Igfbpl1 (NM_018741) Mouse Recombinant Protein
CAT#: TP503600
Purified recombinant protein of Mouse insulin-like growth factor binding protein-like 1 (Igfbpl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203600 representing NM_018741
Red=Cloning site Green=Tags(s) MPRLPLLLLLLPSLARGLGLRDAGRRHPECSPCQQDRCPAPSPCPAPWISARDECGCCARCLGAEGASCG GPVGSRCGPGLVCASRASGTAPEGTGLCVCAQRGAVCGSDGRSYSSICALRLRARHAPRAHHGHLHKARD GPCEFAPVVLMPPRDIHNVTGTQVFLSCEVKAVPTPVITWKKVKHSPEGTEGLEELPGDHVNIAVQVRGG PSDHETTSWILINPLRKEDEGVYHCHAANAIGEAQSHGTVTVLDLNRYKSLYSSVPGDLL myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 29 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_061211 |
| Locus ID | 75426 |
| UniProt ID | Q80W15 |
| Refseq Size | 2729 |
| Cytogenetics | 4 B1 |
| Refseq ORF | 810 |
| Synonyms | 2810011G06Rik; 2810453O06Rik; IGFBPL |
| Summary | IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Igfbpl1产品
