Ttc19 (BC037111) Mouse Recombinant Protein

CAT#: TP503543

Purified recombinant protein of Mouse tetratricopeptide repeat domain 19 (cDNA clone MGC:47198 IMAGE:5370464), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Rabbit Polyclonal Anti-TTC19 Antibody
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203543 representing BC037111
Red=Cloning site Green=Tags(s)

MKDEPEAAELILHDALRLAYESDNRKAITYTYDLMANLAFIRGQLENAEQLFKATMSYLLGGGMKQEDNA
IIEISLKLANIYAAQNKQEFALAGYEFCISTLEGKIEREKELAEDIMSEETANTYLLLGMCLDSCARYLL
FSKQLSQAQRMYEKALQICQEIQGERHPQTIVLMSDLATTLDAQGHFDDAYIYMQRASDLAREINHPELH
MVLSNLAAILIHRERYTQAKEIYQEALKRAELKRDEVSVQHIREELAELSRKSRRLT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 93.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 72795
UniProt ID Q8CC21
Refseq Size 2548
Cytogenetics 11 B2
Refseq ORF 801
Synonyms 2010204O13Rik; 2810460C24Rik; AI505442
Summary Required for the preservation of the structural and functional integrity of mitochondrial respiratory complex III by allowing the physiological turnover of the Rieske protein UQCRFS1 (PubMed:21278747, PubMed:28673544). Involved in the clearance of UQCRFS1 N-terminal fragments, which are produced upon incorporation into the complex III and whose presence is detrimental for its catalytic activity (PubMed:28673544).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...