Ttc19 (BC037111) Mouse Recombinant Protein
CAT#: TP503543
Purified recombinant protein of Mouse tetratricopeptide repeat domain 19 (cDNA clone MGC:47198 IMAGE:5370464), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203543 representing BC037111
Red=Cloning site Green=Tags(s) MKDEPEAAELILHDALRLAYESDNRKAITYTYDLMANLAFIRGQLENAEQLFKATMSYLLGGGMKQEDNA IIEISLKLANIYAAQNKQEFALAGYEFCISTLEGKIEREKELAEDIMSEETANTYLLLGMCLDSCARYLL FSKQLSQAQRMYEKALQICQEIQGERHPQTIVLMSDLATTLDAQGHFDDAYIYMQRASDLAREINHPELH MVLSNLAAILIHRERYTQAKEIYQEALKRAELKRDEVSVQHIREELAELSRKSRRLT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 93.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 72795 |
UniProt ID | Q8CC21 |
Refseq Size | 2548 |
Cytogenetics | 11 B2 |
Refseq ORF | 801 |
Synonyms | 2010204O13Rik; 2810460C24Rik; AI505442 |
Summary | Required for the preservation of the structural and functional integrity of mitochondrial respiratory complex III by allowing the physiological turnover of the Rieske protein UQCRFS1 (PubMed:21278747, PubMed:28673544). Involved in the clearance of UQCRFS1 N-terminal fragments, which are produced upon incorporation into the complex III and whose presence is detrimental for its catalytic activity (PubMed:28673544).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |