Rchy1 (NM_026557) Mouse Recombinant Protein

CAT#: TP503406

Purified recombinant protein of Mouse ring finger and CHY zinc finger domain containing 1 (Rchy1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203406 protein sequence
Red=Cloning site Green=Tags(s)

MAATAREDGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQH
AQQTCEDCSTLFGEYYCSICHLFDKDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIENV
SRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDTEVAQTPMP
SEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRRVPVDQQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080833
Locus ID 68098
UniProt ID Q9CR50
Refseq Size 2029
Cytogenetics 5 E2
Refseq ORF 783
Synonyms ARNIP; CHIMP; Pi; Pirh2; PRO1; Zfp36; Zfp363; Znf363
Summary This gene encodes a protein containing CHY-, CTCHY-, and RING-type zinc-fingers. The encoded protein functions as an E3 ubiquitin ligase, and mediates the degradation of target proteins such as p53. The activity of this protein is important in cell cycle regulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...