Rab26 (NM_177375) Mouse Recombinant Protein

CAT#: TP503367

Purified recombinant protein of Mouse RAB26, member RAS oncogene family (Rab26), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203367 protein sequence
Red=Cloning site Green=Tags(s)

MSRKKTPKSKGGSEPATSTLPAAAAATNGPRLAHPRTVRPGPEAPPNGPPQSIRPSLGSTGDFYDVAFKV
MLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQIWDTAGQERFRSVTHAYYRD
AHALLLLYDITNKDSFDNIQAWLTEIQEYAQQDVVLMLLGNKVDSTQDRVVKREDGEKLAKEYGLPFMET
SARTGLNVDLAFTAIAKELKQRSAKAPSEPRFRLHDYVKREGRGVSCCRL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_796349
Locus ID 328778
UniProt ID Q504M8
Refseq Size 1434
Cytogenetics 17 A3.3
Refseq ORF 780
Synonyms A830020M03Rik
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Mediates transport of ADRA2A and ADRA2B from the Golgi to the cell membrane. Plays a role in the maturation of zymogenic granules and in pepsinogen secretion in the stomach (By similarity). Plays a role in the secretion of amylase from acinar granules in the parotid gland.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...