Eif4e2 (BC049077) Mouse Recombinant Protein
CAT#: TP503331
Purified recombinant protein of Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203331 protein sequence
Red=Cloning site Green=Tags(s) MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPG RPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIAPQGTMSSKLCLMVNPLKVTRPHASTFPLGSVHQQI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 26987 |
UniProt ID | Q8BMB3 |
Refseq Size | 2855 |
Cytogenetics | 1 C5 |
Refseq ORF | 771 |
Synonyms | 2700069E09Rik; AI036339; AV129531; D0H0S6743E; Eif4el3 |
Summary | Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:15153109). Acts as a repressor of translation initiation (By similarity). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (PubMed:15153109).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |