Nt5c3l (BC015307) Mouse Recombinant Protein

CAT#: TP503318

Purified recombinant protein of Mouse 5'-nucleotidase, cytosolic III-like (cDNA clone MGC:19356 IMAGE:4239117), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203318 protein sequence
Red=Cloning site Green=Tags(s)

MTLSRFAYNGQRCPSSHNILDNSKIISEDCRKELTELFHHYYPIEIDPHRTIKEKLPHMVQWWSKAHSLL
CQQRIQKVQIAQVVGESTAMLREGYKTFFDTLYQNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNY
MDFSEDGFLKGFKGQLIHTYNKNSSVCENSSYFQQLQNKTNIILLGDSIGDLTMADGVPGVQNILKIGFL
NDKVEERRERYMDSYDIVLEKDETLDVVNGLLRHILYQGDCVELQGS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 68106
UniProt ID Q3UFY7
Refseq Size 1390
Cytogenetics 11 D
Refseq ORF 771
Synonyms 2610037D24Rik; AI841843; C330027I04Rik; Nt5c3l
Summary Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate. The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids. Also has weak activity for CMP. UMP and purine nucleotides are poor substrates (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...