Nt5c3l (BC015307) Mouse Recombinant Protein
CAT#: TP503318
Purified recombinant protein of Mouse 5'-nucleotidase, cytosolic III-like (cDNA clone MGC:19356 IMAGE:4239117), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR203318 protein sequence
Red=Cloning site Green=Tags(s) MTLSRFAYNGQRCPSSHNILDNSKIISEDCRKELTELFHHYYPIEIDPHRTIKEKLPHMVQWWSKAHSLL CQQRIQKVQIAQVVGESTAMLREGYKTFFDTLYQNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNY MDFSEDGFLKGFKGQLIHTYNKNSSVCENSSYFQQLQNKTNIILLGDSIGDLTMADGVPGVQNILKIGFL NDKVEERRERYMDSYDIVLEKDETLDVVNGLLRHILYQGDCVELQGS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 29.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 68106 |
| UniProt ID | Q3UFY7 |
| Refseq Size | 1390 |
| Cytogenetics | 11 D |
| Refseq ORF | 771 |
| Synonyms | 2610037D24Rik; AI841843; C330027I04Rik; Nt5c3l |
| Summary | Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate. The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids. Also has weak activity for CMP. UMP and purine nucleotides are poor substrates (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
