Mettl8 (NM_145524) Mouse Recombinant Protein

CAT#: TP503258

Purified recombinant protein of Mouse methyltransferase like 8 (Mettl8), transcript variant a, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
METTL8 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203258 protein sequence
Red=Cloning site Green=Tags(s)

MQWSKEEEDAARKKVEENSATRVAPEEQVKFESDANKYWDTFYQTHKNKFFKNRNWLLREFPEILPVNQN
TKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGWSAPDPDLEEYSKGPGKTEPFPGSNATFRI
LEVGCGAGNSVFPILNTLQNIPGSFLYCCDFASEAVELVKSHKSYSETQCSAFIHDVCDDGLAYPFPDGI
LDVVLLVFVLSSIHPDRQVPPCLPNRTCDFYKMSQPPGRGYRPA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_663499
Locus ID 228019
UniProt ID A2AUU0
Refseq Size 2370
Cytogenetics 2 C2
Refseq ORF 762
Synonyms BC004636; T; Tip
Summary This locus encodes a member of the methyltransferase family, and is involved in chromatin remodeling. Transcripts from this locus can be induced or inhibited by cell stretch and affect cell differentiation in the myogenic or adipogenic pathways. Multiple transcript variants encoding different isoforms have been found for this gene. Additional splice variants have been described in the literature but they meet nonsense-mediated decay (NMD) criteria and are likely to be degraded as soon as they are transcribed. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...