Ska1 (NM_001164355) Mouse Recombinant Protein

CAT#: TP503253

Purified recombinant protein of Mouse spindle and kinetochore associated complex subunit 1 (Ska1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Ska1 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203253 protein sequence
Red=Cloning site Green=Tags(s)

MDSELEDLCSYVNEKIGNIKKILSIRNLGQDPALKTTLSKIGDEIIAVNELLNKFELEIQYQEQTNSSLK
ELCESLREECEDVEHLKEHVPPHLPQVTATQSLVHKPEPDPKESDKAEEPGLPKKPPREQRVIKEMQFIT
MDEFSDVPAYMKSRLTYCQINDIIKEINKAVVSKYKIMHQPKASMSSVKRNLYQRFINEETKDTKGHHFI
VEADIKEFTALKVDKRFYVIMHILRHCHRLSEVRGGGLTRYVIT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001157827
Locus ID 66468
UniProt ID Q9CPV1
Refseq Size 2605
Cytogenetics 18 E2
Refseq ORF 762
Synonyms 2810433K01Rik; AV117428
Summary Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules. In the complex, it mediates the interaction with microtubules.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...