Pagr1a (NM_030240) Mouse Recombinant Protein
CAT#: TP503226
Purified recombinant protein of Mouse PAXIP1 associated glutamate rich protein 1A (Pagr1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203226 protein sequence
Red=Cloning site Green=Tags(s) MSLALGHGTIAGSTAAPLSEEGEVTSGLQALAVEDTGGPSVSASKAEEEGKGSQEEAGREGSRPEEALEA PSAASDERAEGEAEDWCVPCSDEEVELPANGQSWMPPPSEIQRLYELLATQGTLELQAEILPRRPPTPEA QSEEERSDEEPEAKEEEEEKPHMPTEFDFDDEPMTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRH KKLEEQILRTGRDLFSLDSEGPSPTSPPLRSSGNSLFPRQRKY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_084516 |
Locus ID | 67278 |
UniProt ID | Q99L02 |
Refseq Size | 1448 |
Cytogenetics | 7 F3 |
Refseq ORF | 759 |
Synonyms | 2900092E17Rik; C77040; PA1; PAGR1 |
Summary | Its association with the histone methyltransferase MLL2/MLL3 complex is suggesting a role in epigenetic transcriptional activation. However, in association with PAXIP1/PTIP is proposed to function at least in part independently of the MLL2/MLL3 complex. Proposed to be recruited by PAXIP1 to sites of DNA damage where the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage independently of the MLL2/MLL3 complex (PubMed:19124460). However, its function in DNA damage has been questioned (PubMed:26744420). During immunoglobulin class switching in activated B-cells is involved in transcription regulation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus independently of the MLL2/MLL3 complex (PubMed:26744420). Involved in both estrogen receptor-regulated gene transcription and estrogen-stimulated G1/S cell-cycle transition (By similarity). Acts as transcriptional cofactor for nuclear hormone receptors. Inhibits the induction properties of several steroid receptors such as NR3C1, AR and PPARG; the mechanism of inhibition appears to be gene-dependent (By similarity). May be involved in the regulation of the BMP pathway in extraembryonic development (PubMed:24633704).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...