Clic5 (NM_172621) Mouse Recombinant Protein

CAT#: TP503209

Purified recombinant protein of Mouse chloride intracellular channel 5 (Clic5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203209 protein sequence
Red=Cloning site Green=Tags(s)

MTDSATTNGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT
HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG
LTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE
MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVARRLSRS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_766209
Locus ID 224796
UniProt ID Q8BXK9
Refseq Size 5870
Cytogenetics 17 B3
Refseq ORF 753
Synonyms 5730531E12Rik; B330005L24; Gm322; jbg
Summary Required for normal hearing (By similarity). It is necessary for the formation of stereocilia in the inner ear and normal development of the organ of Corti. Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture (PubMed:17021174). Plays a role in formation of the lens suture in the eye, which is important for normal optical properties of the lens (PubMed:29425878).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...