Fcgr4 (NM_144559) Mouse Recombinant Protein
CAT#: TP503178
Purified recombinant protein of Mouse Fc receptor, IgG, low affinity IV (Fcgr4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203178 representing NM_144559
Red=Cloning site Green=Tags(s) MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQD ANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTY SQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLI GLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653142 |
Locus ID | 246256 |
UniProt ID | A0A0B4J1G0 |
Refseq Size | 1304 |
Cytogenetics | 1 78.53 cM |
Refseq ORF | 747 |
Synonyms | 4833442P21Rik; CD16-2; FcgammaRIV; Fcgr3a; FcgRIV; Fcrl3 |
Summary | Receptor for the Fc region of immunoglobulin gamma (PubMed:16039578). Also acts as a receptor for the Fc region of immunoglobulin epsilon (PubMed:17558411, PubMed:18949059). Binds with intermediate affinity to both IgG2a and IgG2b (PubMed:16039578, PubMed:17558411, PubMed:19795417). Can bind to IgG2a and IgG2b monomers (PubMed:18949059). Does not display binding to IgG1 or IgG3 (PubMed:16039578). Mediates neutrophil activation by IgG complexes redundantly with Fcgr3 (PubMed:18097064). Plays a role in promoting bone resorption by enhancing osteoclast differentiation following binding to IgG2a (PubMed:25824719). Binds with low affinity to both the a and b allotypes of IgE (PubMed:18949059). Has also been shown to bind to IgE allotype a only but not to allotype b (PubMed:17558411). Binds aggregated IgE but not the monomeric form and bound monomeric IgG is readily displaced by IgE complexes (PubMed:18949059). Binding to IgE promotes macrophage-mediated phagocytosis, antigen presentation to T cells, production of proinflammatory cytokines and the late phase of cutaneous allergic reactions (PubMed:17558411, PubMed:18949059).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...