Ywhag (NM_018871) Mouse Recombinant Protein
CAT#: TP503103
Purified recombinant protein of Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (Ywhag), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203103 protein sequence
Red=Cloning site Green=Tags(s) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061359 |
Locus ID | 22628 |
UniProt ID | P61982 |
Refseq Size | 3592 |
Cytogenetics | 5 G2 |
Refseq ORF | 741 |
Synonyms | 14-3-3gamma; D7Bwg1348e |
Summary | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |