Nudt18 (BC036718) Mouse Recombinant Protein

CAT#: TP503089

Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 18 (cDNA clone MGC:38179 IMAGE:5322150), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203089 protein sequence
Red=Cloning site Green=Tags(s)

MEPGETIVEAMQREVKEEAGLLCEPVTLLSVEERGASWIRFVFLARPTGGVLKTSKDADSESLQAGWYPR
VSLPTPLRAHDVLHLVELGAKFCQQAMHPLILPQELPCSVVCQRLVTTFTTVQSVWVLVGTVGTPHLPIT
ACGFTPMEQRGGIKVAILRLLQECLTLHSLAVETKGLLGLQHLGRDHVDGVCLNVLVTVAFRNPGIQDEP
PKIRGENYFWWKVLEEDLQKLLLYRLQESSVIPLSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 213484
UniProt ID Q3U2V3
Refseq Size 1630
Cytogenetics 14 D2
Refseq ORF 738
Synonyms MGC38179
Summary Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Exhibited no or minimal hydrolyzis activity against 8-oxo-dGTP, 8-oxo-GTP, dGTP, GTP, dGDP and GDP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...