D2Ertd750e (BC031709) Mouse Recombinant Protein
CAT#: TP502833
Purified recombinant protein of Mouse DNA segment, Chr 2, ERATO Doi 750, expressed (cDNA clone MGC:30961 IMAGE:4021550), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202833 protein sequence
Red=Cloning site Green=Tags(s) MASAKTVCDAQPHSMPSCGLPADTQTRATSKLPVKSKEADLLRHLHPGGPEPDVTKVTKSRRENGQVKAA ETASRRNLRNSYKPFNKQKPEEELKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLALL ESKGLNPGQETLASKQEPTTDHTDSMLLLETLKDELKVFNETAKKQMEELQALKVKLKLKEEESVQFLEQ QTLCKDEASDFTIILEEMEQLLEM myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 26.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 51944 |
| UniProt ID | Q9D9Z1 |
| Refseq Size | 1218 |
| Cytogenetics | 2 E5 |
| Refseq ORF | 702 |
| Synonyms | 1700025D04Rik; C15orf23; D2Ertd750e; SKAP; Traf4af1 |
| Summary | Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它D2Ertd750e产品
