Tada3l (BC022707) Mouse Recombinant Protein
CAT#: TP502807
Purified recombinant protein of Mouse transcriptional adaptor 3 (NGG1 homolog, yeast)-like (cDNA clone MGC:31487 IMAGE:4486171), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202807 protein sequence
Red=Cloning site Green=Tags(s) MQEDLLEEQKDGARAAAVADKKKGLIGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVE ENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSED EVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTK KEKDQAWKTLKERESILKLLDG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 101206 |
UniProt ID | Q8R0L9 |
Refseq Size | 1290 |
Cytogenetics | 6 E3 |
Refseq ORF | 696 |
Synonyms | 1110004B19Rik; ADA3; AI987856; Tada3l |
Summary | Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation (By similarity). Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |