Kctd11 (NM_153143) Mouse Recombinant Protein
CAT#: TP502806
Purified recombinant protein of Mouse potassium channel tetramerisation domain containing 11 (Kctd11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202806 representing NM_153143
Red=Cloning site Green=Tags(s) MLGAMFRADTLMPANLNPQGDGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLKAEADFYQIRPLL DALRELEASRGTPASTAALLHADVDVSPRQVHFSARRGPHHYELSSVQVDTFRANLFCTDPECLAAMRNR FGVAIGDRAEGGPHFRLEWASRPQELPEVEYQRLGLQPLWTGGPEDRREVANTPTFLEEVLRVALEHGFR LDSVFPDPEDLLNSRSLRFVRH myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 26.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_694783 |
| Locus ID | 216858 |
| UniProt ID | Q8K485 |
| Refseq Size | 2740 |
| Cytogenetics | 11 B3 |
| Refseq ORF | 696 |
| Synonyms | AF465352; Ren |
| Summary | Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. When knock-down, Hedgehog antagonism is impaired and proliferation of granule cells is sustained. Activates the caspase cascade.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
