Rae1 (BC060072) Mouse Recombinant Protein
CAT#: TP502613
Purified recombinant protein of Mouse RAE1 RNA export 1 homolog (S. pombe) (cDNA clone MGC:73449 IMAGE:5718934), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR202613 protein sequence
Red=Cloning site Green=Tags(s) MSLFGSTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPN YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVLATAERGLIVYQLENQPSEFRRIESP LKHQVGATALRSAR myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 66679 |
| UniProt ID | Q8C570 |
| Refseq Size | 4222 |
| Cytogenetics | 2 95.66 cM |
| Refseq ORF | 672 |
| Synonyms | 41, MNRP, MNRP41 |
| Summary | Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
